PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G001500.3
Common NameB456_011G001500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 351aa    MW: 38745.5 Da    PI: 6.0937
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G001500.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-33227281155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr+rWtpeLHerFveav++L G+ekAtPk +l+lm+v+gLt++hvkSHLQkYRl
  Gorai.011G001500.3 227 KPRMRWTPELHERFVEAVNKLHGPEKATPKGVLKLMNVEGLTIYHVKSHLQKYRL 281
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.732224284IPR017930Myb domain
SuperFamilySSF466892.33E-18225281IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-25227282IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.3E-31227282IPR009057Homeodomain-like
PfamPF002496.3E-10229280IPR001005SANT/Myb domain
PfamPF143792.3E-10318340IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MTQSEPSKGI GERYPIAAFP AHKILSIKSE GQSSMAGECS SRLSFPFNSP RSDAKNASSS  60
SSVFCTSLYL SSSSTSETQR QLGNLPFLPH PPTRHQFISS VDSSKSPAMF SEDLNNPYNE  120
GHSEIIMKDF LNLPADASSD GCFYGMHCES DDFGITTEQL ELQFLSDELD IAITDHGENP  180
RLDEIYETCP PSSAKPTVEL KCNQNTNSVS PTIDGPAMSG AAAAVLKPRM RWTPELHERF  240
VEAVNKLHGP EKATPKGVLK LMNVEGLTIY HVKSHLQKYR LAKYMPEKKE ERKTSSSSEE  300
KKPASSSNES DGKKRGGMHI TEALRMQMEV QKQLHEQLEV FIMFVAECTN *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.12780.0flower| flowering
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO488069450.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454325.10.0PREDICTED: uncharacterized protein LOC105776298
RefseqXP_012454324.10.0PREDICTED: uncharacterized protein LOC105776298
TrEMBLA0A0D2SZU60.0A0A0D2SZU6_G
STRINGPOPTR_0014s00280.11e-124(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.27e-89G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]